PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_02529
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family Nin-like
Protein Properties Length: 732aa    MW: 82397 Da    PI: 5.9595
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_02529genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.51.3e-28446496252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 ek isle+l++yF++ +kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rki+++
  PEQU_02529 446 EKIISLEVLQQYFKGCLKDAAKSLGVCPTTLKRICRQHGISRWPSRKINKV 496
                 899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029435516IPR003035RWP-RK domain
PfamPF020421.1E-25449496IPR003035RWP-RK domain
SuperFamilySSF542773.17E-19627717No hitNo description
PROSITE profilePS5174518.516635717IPR000270PB1 domain
PfamPF005645.3E-15635716IPR000270PB1 domain
SMARTSM006661.8E-19635717IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.6E-22635716No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MMKERMMQAL RYFKEWTNHH VLVQFWVPVR NEDRYVLTTS EQPFVLDPDA NGLLQYRTVS  60
LMYLFSFDED NDGALGLPGR VFKLKLPEWT PNVQYYSSKE YPRLSHALLY NVRGSLGLPV  120
FEPSSQSCVG VVELITTSEM VNYAPEVDKV CKALEAVNLR SSKILEDQSI QSCNEGRHAA  180
LVEILEILTV VCEAQKLPLA QTWVPCQHDN ILAHRDSPTC DGSCMGHVCM STSGAAFHVV  240
DAHMWGFRDA CSEHHLQKGQ GVVGRAFAAK HSCFCSDITK FSKTEYPLVH YAQMFGLGSC  300
LALFLRSSHS EDDVYIAEFF LPSDCKDLIR QRALLESIST LLKQSFQSLK VIIGAEVEGQ  360
PFEFIDIISY ANHEMQHVQD ALPTINTLEG LHEKECKCNT DHSTPEQHLV SCINSDKSTT  420
LHENGCIPAS TIITNEVAGR KRGKAEKIIS LEVLQQYFKG CLKDAAKSLG VCPTTLKRIC  480
RQHGISRWPS RKINKVNRSI SELKHVIESV QNVDVALNVN PLIRPLLLTP GTMSLPVQLD  540
RDSVSRAENT SHFKTLEVND SHDKVTSKEQ PFSTNSNQYA SVINFLEDQN MVPLSSRTDV  600
VLEPELAESD ILIEDSTSSK SARNPPSTFI QDRKTVVVKA HYKEDIIRFR MVNDAGIMAL  660
AEEIGKRLML EVGSFEIKYL DDDHDWVRLH CDEDLEECLE ISSMSDSSVI RLSVQDICLK  720
APKNVRPEMC IP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1438444GRKRGKA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008806288.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK3XE990.0K3XE99_SETIT; Uncharacterized protein
STRINGSi000216m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein